DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:138 Identity:58/138 - (42%)
Similarity:76/138 - (55%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQE---DGIYNYQFETSNGIAQQEQGV----- 63
            ::.:|..:|...||||.....|..|....:.: :||   ||.|.|.:||.|||..:|:|.     
  Fly     5 LLFIAALLLSLAQARPQVRGQAPGEPIPIIRQ-EQEVNFDGSYKYLYETGNGINAEEEGYLKNPG 68

  Fly    64 ---GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHP---- 121
               .|..|.||..|.:|||..|::||.||||||||||:|||||.|||.||.|:|.|....|    
  Fly    69 TDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAPPPPQ 133

  Fly   122 EEDGEYEH 129
            |:.|.:.:
  Fly   134 EQPGGFNN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 24/54 (44%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.