DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR81

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_318999.3 Gene:CPR81 / 1279298 VectorBaseID:AGAP009879 Length:131 Species:Anopheles gambiae


Alignment Length:144 Identity:42/144 - (29%)
Similarity:63/144 - (43%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KINVVVLVAMSVLLGVQARP----------SDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIA 57
            |..|:::.|:......|.||          ...|:|.|.|.:.|.| ...||.|.|.:||||||.
Mosquito     2 KFVVLLVAALVAATSAQIRPLPIPLRNPGVYGGPEASAVILNQVYE-PNPDGSYVYSYETSNGIR 65

  Fly    58 QQEQGV--------GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSL 114
            ..::|.        ......||..|..|:|.:..:.|.|||||::.:|.|:|:          :.
Mosquito    66 ADQRGFLKNPGTPGEAQVMQGSYSYTGPDGVVYTINYIADENGYRAEGAHIPS----------AP 120

  Fly   115 EYNRNHPEEDGEYE 128
            .||..:|   |:|:
Mosquito   121 RYNPRYP---GQYQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/54 (35%)
CPR81XP_318999.3 Chitin_bind_4 54..109 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.