DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR78

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_318996.4 Gene:CPR78 / 1279295 VectorBaseID:AGAP009876 Length:137 Species:Anopheles gambiae


Alignment Length:135 Identity:55/135 - (40%)
Similarity:71/135 - (52%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLVAMSVLL----GVQARPSDSPDAHAEIRSFVNELKQE-----DGIYNYQFETSNGIAQQEQG 62
            |::.|..|||    ||:..|.........|      ::||     ||.|::.:||.|||..:|||
Mosquito     3 VIICACVVLLLAFGGVECAPQGPATEPIPI------IRQEQEVNPDGSYSWSYETGNGIVAEEQG 61

  Fly    63 V--------GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRN 119
            .        ....|.|...|..|:||||::.|.||||||||.|:|||||.|||.||.::|||..:
Mosquito    62 FLKNPGTEQEAQVAQGEYSYTAPDGQLIRVQYIADENGFQPLGDHLPTPPPIPPAIQRALEYLAS 126

  Fly   120 HPEED 124
            .|..|
Mosquito   127 LPPSD 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 22/54 (41%)
CPR78XP_318996.4 Chitin_bind_4 45..100 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.