DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR76

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_318993.4 Gene:CPR76 / 1279293 VectorBaseID:AGAP009874 Length:268 Species:Anopheles gambiae


Alignment Length:113 Identity:42/113 - (37%)
Similarity:60/113 - (53%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG--------VGGYYASGSSQY 74
            |..:|:.:||....|| ..|:: :.|| |:|.|||.|||..:|.|        ..|..:.|..||
Mosquito   162 VAPKPAYAPDGWKIIR-LENQV-ENDG-YHYVFETENGILAEEAGRIEDKGTAAEGLRSQGFYQY 223

  Fly    75 YTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPE 122
            ...:|.:.::.|.||.|||.|||:|:|   .:|.||.|.|:|....|:
Mosquito   224 VGDDGVVYRVDYVADGNGFLPQGDHIP---KVPPAIEKLLKYLAAQPK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/54 (35%)
CPR76XP_318993.4 Chitin_bind_4 187..242 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.