DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR74

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_318987.4 Gene:CPR74 / 1279288 VectorBaseID:AGAP009869 Length:122 Species:Anopheles gambiae


Alignment Length:116 Identity:48/116 - (41%)
Similarity:64/116 - (55%) Gaps:25/116 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVAMSVLLG--VQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG--------- 62
            |:|:.||:.  |.|.|.|| ||.|:|.|..::: |.||.:||.||::|||..::||         
Mosquito     4 LLALVVLMAATVYAAPVDS-DAQAQIVSQTSDV-QPDGSFNYAFESANGIKVEDQGSIKSIKVPK 66

  Fly    63 ------------VGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101
                        |.....:||.||..|:||:..|.|.|||||||||.:|||
Mosquito    67 LDETGRQIGEEDVQVSVQTGSFQYTAPDGQVYTLRYIADENGFQPQADHLP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 23/67 (34%)
CPR74XP_318987.4 Chitin_bind_4 41..109 CDD:278791 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.