DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR106

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_316152.4 Gene:CPR106 / 1276767 VectorBaseID:AGAP006095 Length:150 Species:Anopheles gambiae


Alignment Length:135 Identity:49/135 - (36%)
Similarity:75/135 - (55%) Gaps:8/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKINVVVL-VAMSVLLG------VQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQ 58
            |.|.::::| .|:::.|.      .:..|...||:.|.:.: .:::..|.|.|.|.:||||||..
Mosquito     1 MYKQSLILLSCALALTLAAPPAPLTKRSPQGGPDSEATVVA-QDQIINEGGSYAYNYETSNGIKA 64

  Fly    59 QEQGVGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEE 123
            ::....|..|:|...:..|:|....:.|.||||||||||.||||..|.||.::|.||..|.:|..
Mosquito    65 RQTSDNGVSANGEYSFLAPDGTSYSVVYVADENGFQPQGAHLPTEPPAPEHVIKLLEDLRANPPS 129

  Fly   124 DGEYE 128
            |.|::
Mosquito   130 DPEFD 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 18/46 (39%)
CPR106XP_316152.4 Chitin_bind_4 52..99 CDD:278791 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9572
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3799
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.