DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR32

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_316045.2 Gene:CPR32 / 1276675 VectorBaseID:AGAP006012 Length:156 Species:Anopheles gambiae


Alignment Length:168 Identity:49/168 - (29%)
Similarity:71/168 - (42%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVVVLVAMSVLLGVQARPSDS---------------PDAHAEIRSFVNELKQEDGIYNYQFETS 53
            :.:.:..::.|||......:|.               |..|:|..|      ..||.|.:.:|:.
Mosquito     1 MKMFITASLGVLLVASLAAADQYHHAPEYDHAPAKQIPIVHSESYS------SHDGSYKFAYESG 59

  Fly    54 NGIAQQEQG----VGG-----YYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEA 109
            |||..||:|    .|.     ..|.||..|..|.|..:.|:|.|||||||.||.|:|||.|:|:.
Mosquito    60 NGITAQEEGFVKNAGSKDHEVQVAHGSYSYTDPHGVPVSLSYVADENGFQVQGSHVPTPPPVPKE 124

  Fly   110 ILKSLEYNRNHPEEDGEYEHHDHHHDHHEH---HQSHG 144
            ::.:.....:.|:.          ||..|:   .|.||
Mosquito   125 LVDAYAKAASQPQS----------HDEPEYAQPAQQHG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 21/55 (38%)
CPR32XP_316045.2 Chitin_bind_4 52..108 CDD:278791 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.