DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR16

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_315462.3 Gene:CPR16 / 1276152 VectorBaseID:AGAP005459 Length:136 Species:Anopheles gambiae


Alignment Length:119 Identity:54/119 - (45%)
Similarity:76/119 - (63%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYASG 70
            |.|:.|::.:...|     :|||.|::.| .:.:...||.|.:.:||||||..|||||||..|.|
Mosquito     4 VFVIAALAAVAVAQ-----NPDADAQVLS-SDSVVNPDGSYQWNYETSNGIRAQEQGVGGQSAQG 62

  Fly    71 SSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEED 124
            |:.:...:|..|.|||.|||||:||||:|||...|:|..:||:||:.|.:|.:|
Mosquito    63 SASWTDRDGTPISLTYVADENGYQPQGDHLPREGPVPAHVLKTLEFIRANPPKD 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 26/46 (57%)
CPR16XP_315462.3 Chitin_bind_4 38..85 CDD:278791 26/46 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9572
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3799
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.