DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR13

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_315457.1 Gene:CPR13 / 1276147 VectorBaseID:AGAP005454 Length:146 Species:Anopheles gambiae


Alignment Length:124 Identity:60/124 - (48%)
Similarity:82/124 - (66%) Gaps:8/124 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLVAMSVLLGVQARPSD-------SPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGG 65
            |..|..::..|.|.|.|       :|||||:|.::.|.|| :||.||:.:|||||||..|:|:|.
Mosquito     5 VFAAALLVATVAAGPLDRAYSHQQNPDAHAQIVAYENVLK-DDGHYNWSYETSNGIAAHEEGLGA 68

  Fly    66 YYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEED 124
            :.|:|:..|..|:|.|.::.|.||||||||||:|||||.|.||.:.|:||..|.:|.:|
Mosquito    69 HNANGAFSYTGPDGVLYRVVYVADENGFQPQGDHLPTPPPTPEHVFKTLEQIRANPPKD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 23/46 (50%)
CPR13XP_315457.1 Chitin_bind_4 49..96 CDD:278791 23/46 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I16502
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I7164
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9572
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3799
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.