DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR8

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_312322.1 Gene:CPR8 / 1273355 VectorBaseID:AGAP002613 Length:137 Species:Anopheles gambiae


Alignment Length:112 Identity:32/112 - (28%)
Similarity:48/112 - (42%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLVAMSVLLGVQA-----RPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG----- 62
            ||:|..|:|...|     .|:.......:...:.:|....|| |.:.:|.|:|..:.|.|     
Mosquito    13 VLLAGRVVLSAPAPQQGGAPAGQNPNDVQTVRYYSENNGLDG-YKFTYELSDGQIRSEVGTYRDV 76

  Fly    63 -------VGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPT 102
                   |...:..||..:..|:||...:.|||||||:.|:....||
Mosquito    77 KDAEGKDVKALFVQGSYSFVGPDGQTYWVNYTADENGYHPKVGTGPT 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 18/58 (31%)
CPR8XP_312322.1 Chitin_bind_4 55..114 CDD:278791 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.