DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR113

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_309807.4 Gene:CPR113 / 1271062 VectorBaseID:AGAP010887 Length:322 Species:Anopheles gambiae


Alignment Length:179 Identity:49/179 - (27%)
Similarity:73/179 - (40%) Gaps:51/179 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DGIYNYQFETSNGIAQQEQGV--------GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEH 99
            ||.|.:.:.|.|||..||:|.        .....||...|..|:|||..:.|.||.|||||.|:|
Mosquito   132 DGSYRFDYATGNGIQHQEEGFLRNLGPEKSEQVVSGGYSYTAPDGQLYSVQYKADANGFQPVGDH 196

  Fly   100 LPTPHPIPEAILK----------------------------------SLEYNRNHPEEDGEYEHH 130
            ||||.|:|:|:.:                                  |.:.:..:|::..:.:..
Mosquito   197 LPTPPPLPQALQEAYDLHARLHAEAAARPQNPAYQEPQAQYGAPQGGSQQQSSYYPQQPQQQQQP 261

  Fly   131 DHHHDHHEHHQ-----SHGQEQGKQYLQPAGALLAPASSPVLSVGQVLP 174
            .:||.....:|     .:.|:|..|:..| .|:....|:|   ..|.||
Mosquito   262 QYHHQQQPQYQQPQQPQYNQQQTPQFSSP-NAIQGYPSAP---ANQYLP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/54 (35%)
CPR113XP_309807.4 Chitin_bind_4 135..190 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.