DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR62

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_308723.3 Gene:CPR62 / 1270060 VectorBaseID:AGAP007042 Length:150 Species:Anopheles gambiae


Alignment Length:137 Identity:56/137 - (40%)
Similarity:75/137 - (54%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKINVVVLVAM-SVLLGVQAR-----PSDSPDAHAEIRSFVNELKQE-----DGIYNYQFETSNG 55
            ||:.::..|.: |||...|.|     |..:.::.|.|      |.||     .|.|||::|||||
Mosquito     3 SKVLILAAVTVCSVLAAPQKRLGGPLPLGTAESQAVI------LAQEQNHDPSGAYNYRYETSNG 61

  Fly    56 IAQQEQGVGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNH 120
            ||.|:....|..|:|...|..|:|.|.::.|.||..||||||.|||...|:|:.:|||||..|.:
Mosquito    62 IAAQQTSYDGANAAGEYSYTGPDGVLYRVAYNADTYGFQPQGAHLPVEPPVPDHVLKSLEEIRAN 126

  Fly   121 PEEDGEY 127
            |..|.|:
Mosquito   127 PPRDQEF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 21/46 (46%)
CPR62XP_308723.3 Chitin_bind_4 52..99 CDD:278791 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9572
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3799
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.