Sequence 1: | NP_648076.3 | Gene: | Cpr65Eb / 38774 | FlyBaseID: | FBgn0035736 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003435731.1 | Gene: | CPR139 / 11175635 | VectorBaseID: | AGAP013248 | Length: | 466 | Species: | Anopheles gambiae |
Alignment Length: | 235 | Identity: | 46/235 - (19%) |
---|---|---|---|
Similarity: | 73/235 - (31%) | Gaps: | 101/235 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 DSPDAHAEIRSFVNELKQEDGIYNYQFE---TSNGIAQQEQGVGGYYASGSSQYYTPEGQLIQLT 85
Fly 86 YTADENGFQPQGE----------HLPTPHP--------------------IPEAILKSLE----- 115
Fly 116 -----YN--------------------RNHPEEDGE-------------YEHHDHHHDHHEHHQS 142
Fly 143 HGQEQGKQYLQPAGALLAPASSPVLS--VGQV----LPYD 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr65Eb | NP_648076.3 | Chitin_bind_4 | 46..93 | CDD:278791 | 14/49 (29%) |
CPR139 | XP_003435731.1 | Chitin_bind_4 | 68..120 | CDD:278791 | 14/51 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |