DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and QDR1

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_012146.1 Gene:QDR1 / 854686 SGDID:S000001382 Length:563 Species:Saccharomyces cerevisiae


Alignment Length:64 Identity:16/64 - (25%)
Similarity:29/64 - (45%) Gaps:6/64 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LANQDTDGTYAYDIEQASGIQIKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLL 91
            :|.::.:|:...:::::|...|.:...   |...|:|.|..|.....|.|:  .|. |.|..||
Yeast    14 IAKEEREGSDNNNVDRSSSDAISDNDA---ERSNSHSEIDNESNFDMVPYS--RFS-HKQKMLL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 10/46 (22%)
QDR1NP_012146.1 MFS_Tpo1_MDR_like 72..516 CDD:340881 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11711
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.