powered by:
Protein Alignment Cpr65Ea and QDR1
DIOPT Version :9
Sequence 1: | NP_648075.1 |
Gene: | Cpr65Ea / 38773 |
FlyBaseID: | FBgn0035735 |
Length: | 127 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012146.1 |
Gene: | QDR1 / 854686 |
SGDID: | S000001382 |
Length: | 563 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 64 |
Identity: | 16/64 - (25%) |
Similarity: | 29/64 - (45%) |
Gaps: | 6/64 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LANQDTDGTYAYDIEQASGIQIKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLL 91
:|.::.:|:...:::::|...|.:... |...|:|.|..|.....|.|: .|. |.|..||
Yeast 14 IAKEEREGSDNNNVDRSSSDAISDNDA---ERSNSHSEIDNESNFDMVPYS--RFS-HKQKMLL 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S11711 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.