DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:103 Identity:34/103 - (33%)
Similarity:53/103 - (51%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLVVALFGCALAAPLNDD-TITKFLAN----------QDTDGTYAYDIEQASGIQIKEEGLAGH 57
            |::.||||..|||||..:: ||.:..::          :.:||..|..:.|.:.|..:.|.::  
  Fly     4 LIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAIS-- 66

  Fly    58 EAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTPP 95
             ..|||.:|:.:|...||.|.||:.||.|:...||..|
  Fly    67 -VSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 14/46 (30%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 16/57 (28%)

Return to query results.
Submit another query.