DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:46 Identity:17/46 - (36%)
Similarity:21/46 - (45%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QIKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEF-GFHPQSNLLP 92
            |::|..  |....|.||.|..:|....|.||||.. ||:...|..|
  Fly    79 QVEERD--GDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 13/36 (36%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 13/36 (36%)

Return to query results.
Submit another query.