DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Cpr65Ec

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:114 Identity:47/114 - (41%)
Similarity:69/114 - (60%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLVVAL-FGCALAAPLNDDTITK-FLANQDTDGTYAYDIEQASGIQIKEEGLAGHEAHGSYSYI 66
            :|.|.|| ..|..|...:....|: :.::...||:|||..:.::||..:|.|:.|:.|.||.:|.
  Fly     6 VLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASGSNAYY 70

  Fly    67 SPEGIPVQVVYTADEFGFHPQSNLLPTPPPIPEEILRSIRYIQEHPTPE 115
            :|:|..:|:.||||..|:||....||||||||..||:|:.||:.||..|
  Fly    71 APDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQQE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 19/46 (41%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439260
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.