DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Cpr65Az

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:94 Identity:41/94 - (43%)
Similarity:54/94 - (57%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DDTITKFLANQDTDGTYAYDIEQASGIQIKE---------EGLAGHEAHGSYSYISPEGIPVQVV 76
            |..|.|..:..:|||:|.|:.|..:||:.:|         ||.....|.||:||.||||..:.:.
  Fly   113 DIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    77 YTADEFGFHPQSNLLPTPPPIPEEILRSI 105
            |.|||.||.||.:.||||||||.||..::
  Fly   178 YIADENGFQPQGDHLPTPPPIPIEIQEAL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 21/55 (38%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.