DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Cpr65Az

DIOPT Version :10

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:94 Identity:41/94 - (43%)
Similarity:54/94 - (57%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DDTITKFLANQDTDGTYAYDIEQASGIQIKE---------EGLAGHEAHGSYSYISPEGIPVQVV 76
            |..|.|..:..:|||:|.|:.|..:||:.:|         ||.....|.||:||.||||..:.:.
  Fly   113 DIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    77 YTADEFGFHPQSNLLPTPPPIPEEILRSI 105
            |.|||.||.||.:.||||||||.||..::
  Fly   178 YIADENGFQPQGDHLPTPPPIPIEIQEAL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 21/55 (38%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.