DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:133 Identity:37/133 - (27%)
Similarity:54/133 - (40%) Gaps:38/133 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLLLVVA---LFGCALAAPLND---------DTITKFLANQD----TDGTYAYDIEQASGIQI 49
            ||||:.:|.   |....||.|.:.         .|....:..||    .||::....|.::||::
  Fly     1 MYKLVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRV 65

  Fly    50 KEEG-----------------LAGHE-----AHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLP 92
            :..|                 :..||     ..|||||..|:|..:.:.|.|||.||.|:.:.||
  Fly    66 ENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLP 130

  Fly    93 TPP 95
            ..|
  Fly   131 VAP 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 17/68 (25%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.