DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:127 Identity:37/127 - (29%)
Similarity:52/127 - (40%) Gaps:36/127 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLLLVVALFGCAL--AAPLNDDTIT------KFLANQDTDGTYAYDIEQASGIQIKEEGLAGH 57
            |:.|||:  |.||.|  :.|....:|.      |.:..|.:.|:|.:..|.|.|...:|.|:...
  Fly     1 MFALLLI--LTGCQLLWSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSS 63

  Fly    58 ---------EAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTPPPIPEEILRSIRYIQE 110
                     |..|.|.||:..|..|:|.||||:.||.|.                 :|||.:
  Fly    64 DSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLPH-----------------VRYISK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 18/55 (33%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.