DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and Cpr11B

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:76 Identity:28/76 - (36%)
Similarity:36/76 - (47%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NQDTDGTYAYDIEQASGIQIKEEG-LAGHEAH------GSYSYISPEGIPVQVVYTADEFGFHPQ 87
            |.|.:|.|.:..:..:||...|.| ..|...|      |||||...:|....|.||||:.|||.:
  Fly    78 NSDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFHAE 142

  Fly    88 SNLLPTPPPIP 98
            ...||..|.:|
  Fly   143 GAHLPVSPSVP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 18/53 (34%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.