DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and ADAM2

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001455.3 Gene:ADAM2 / 2515 HGNCID:198 Length:735 Species:Homo sapiens


Alignment Length:44 Identity:16/44 - (36%)
Similarity:19/44 - (43%) Gaps:13/44 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLP 92
            |||    |.|:..||..:. ||.|    ||.:..    |.|.||
Human    37 IKE----GIESQASYKIVI-EGKP----YTVNLM----QKNFLP 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 12/34 (35%)
ADAM2NP_001455.3 Pep_M12B_propep 42..140 CDD:279848 12/35 (34%)
Reprolysin 178..375 CDD:279729
ZnMc_adamalysin_II_like 178..373 CDD:239797
DISIN 393..470 CDD:214490
ACR 472..609 CDD:214743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11711
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.