powered by:
Protein Alignment Cpr65Ea and ADAM2
DIOPT Version :9
Sequence 1: | NP_648075.1 |
Gene: | Cpr65Ea / 38773 |
FlyBaseID: | FBgn0035735 |
Length: | 127 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001455.3 |
Gene: | ADAM2 / 2515 |
HGNCID: | 198 |
Length: | 735 |
Species: | Homo sapiens |
Alignment Length: | 44 |
Identity: | 16/44 - (36%) |
Similarity: | 19/44 - (43%) |
Gaps: | 13/44 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 IKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLP 92
||| |.|:..||..:. ||.| ||.:.. |.|.||
Human 37 IKE----GIESQASYKIVI-EGKP----YTVNLM----QKNFLP 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S11711 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.