DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ea and mes-4

DIOPT Version :9

Sequence 1:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_506333.1 Gene:mes-4 / 179824 WormBaseID:WBGene00003222 Length:898 Species:Caenorhabditis elegans


Alignment Length:62 Identity:16/62 - (25%)
Similarity:21/62 - (33%) Gaps:30/62 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TADEFGFH--PQSNLLP-----------TP----------------PPIPEEILRSIRYIQE 110
            |:.|..||  ||..|.|           ||                ||: :....|::.|||
 Worm   784 TSTELNFHEKPQELLSPVSSRSRAASSSTPRAQKSKSRRDDVESEAPPV-KRATPSLQTIQE 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 2/5 (40%)
mes-4NP_506333.1 PHD_SF 207..269 CDD:304600
SET 537..671 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11711
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.