DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14823 and CG6435

DIOPT Version :9

Sequence 1:NP_729205.1 Gene:CG14823 / 38772 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611165.2 Gene:CG6435 / 36894 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster


Alignment Length:124 Identity:46/124 - (37%)
Similarity:66/124 - (53%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 CLDCMATTATD-NIPAICRHRGRPEEPCGIYRISHVYWQDALRIIDP-DDSLARD-YGRCVVDVQ 199
            ||||:..|.:. |..|||.:..     |||:||:..||.:|.::..| |.:|:.| :..||....
  Fly    29 CLDCLCETMSGCNASAICVNGA-----CGIFRITWGYWVEAGKLTLPTDTALSEDAFTNCVNQPH 88

  Fly   200 CAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLGSLSERRLENCLK 258
            ||...|::|:.:: |:|||||..|:|.|...||..|...|  ||.|..:..:....|||
  Fly    89 CAANTVQNYMFKH-GQDCNGDEHIDCLDFGALHKLGNLKC--QEELPYIFAKVFNRCLK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 43/120 (36%)
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 43/120 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453884
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.