DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14823 and CG6429

DIOPT Version :9

Sequence 1:NP_729205.1 Gene:CG14823 / 38772 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster


Alignment Length:155 Identity:48/155 - (30%)
Similarity:73/155 - (47%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VTAAGVDAQTSTITTFQPPPTSSPEPSAKCLDCMATTATD-NIPAICRHRGRPEEPCGIYRISHV 172
            :|..|:..|...    |.|.|.      :||.||....:. |..|:|.:..     |||:||:..
  Fly    13 LTFVGIWVQAEV----QKPITE------QCLICMCEALSGCNATAVCVNGA-----CGIFRITWD 62

  Fly   173 YWQDALRIIDPDDSLARD--YGRCVVDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRG 235
            .|.|:.|:..|.||...|  :..|..|..||...::||:.:| |:|||.|.:.:|.|:..:|..|
  Fly    63 QWVDSGRLTIPGDSPLTDSSFTNCANDPYCAADTLQSYMVKY-GQDCNDDQKEDCYDYGAIHYMG 126

  Fly   236 PGGCRRQEP--LGSLSERRLENCLK 258
            |..|:...|  ..|:.:|.|.|.::
  Fly   127 PFNCKADMPYTYESIFKRCLRNAMR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 41/124 (33%)
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.