powered by:
Protein Alignment CG14823 and ilys-1
DIOPT Version :9
Sequence 1: | NP_729205.1 |
Gene: | CG14823 / 38772 |
FlyBaseID: | FBgn0035734 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500208.2 |
Gene: | ilys-1 / 183474 |
WormBaseID: | WBGene00016668 |
Length: | 73 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 15/34 - (44%) |
Similarity: | 18/34 - (52%) |
Gaps: | 1/34 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 SYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCR 240
:|..||..: |:|.|..||....|.|..||.|||
Worm 22 NYYHRYKSQ-CDGLGMGECEVFARNHNGGPTGCR 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11195 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.