DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14823 and ilys-5

DIOPT Version :9

Sequence 1:NP_729205.1 Gene:CG14823 / 38772 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 / 180928 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans


Alignment Length:115 Identity:36/115 - (31%)
Similarity:49/115 - (42%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SAKCLDCMATTATDNIPAICRHRGRPEEPCGIYRISHVYWQDALRIIDP----DDSLARDYGRCV 195
            ||.||.|:....:...|..| |.......||.|:|...|::|..:   |    .::....:.||.
 Worm    17 SADCLHCICMRESGCKPIGC-HMDVGSLSCGYYQIKIGYYEDCGQ---PTKKAGETTEAAWKRCA 77

  Fly   196 VDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPL 245
            .|:.||...|.:|..||..: |||.|...|:...|.|..||.||.....|
 Worm    78 DDLNCATTCVENYYNRYKSQ-CNGLGMGACQIMSRNHNGGPRGCHNANTL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 35/114 (31%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14375
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.