DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14823 and ilys-6

DIOPT Version :9

Sequence 1:NP_729205.1 Gene:CG14823 / 38772 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_500470.2 Gene:ilys-6 / 177164 WormBaseID:WBGene00020982 Length:138 Species:Caenorhabditis elegans


Alignment Length:120 Identity:35/120 - (29%)
Similarity:56/120 - (46%) Gaps:17/120 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SAKCLDCMATTATDNIPAICRHRGRPEE----PCGIYRISHVYWQDALRIIDP----DDSLARDY 191
            |:.||.|:....::     |:..|..::    .||.|:|...|::|..:   |    .:|:...:
 Worm    17 SSDCLQCICKKESE-----CKPVGCNDDVGSLSCGYYQIKLSYYKDCGQ---PGKRAGESVEAAW 73

  Fly   192 GRCVVDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLG 246
            .||..::.||...|:||..|| .:.|.|.|:..|....|.|..||.||::...||
 Worm    74 RRCSDELDCASTCVQSYYNRY-KKQCAGTGQGACEIMARNHNGGPRGCKKSATLG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 34/119 (29%)
ilys-6NP_500470.2 Destabilase 17..133 CDD:310240 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DQ45
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14502
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.