DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and RABA1f

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_200894.1 Gene:RABA1f / 836207 AraportID:AT5G60860 Length:217 Species:Arabidopsis thaliana


Alignment Length:226 Identity:50/226 - (22%)
Similarity:102/226 - (45%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 YRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTI-EEFHRKLYRIRNEVFQLDILDTSGYHPFPAM 230
            :::|::|.|..|||::::||..|.|......|| .||..:...:.:::.:..|.||:|...:.|:
plant    14 FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQERYRAI 78

  Fly   231 RRLSFLTGDLFILVFSMDSRESFEEVVR-LRENILETKWAALNPGSGFKKKSLPKIPMILAGNKC 294
            ....:......:||:.:....:||.|.| |:|               .:..:...|.::..|||.
plant    79 TSAYYRGAVGALLVYDVTRHVTFENVERWLKE---------------LRDHTDANIVIMFVGNKA 128

  Fly   295 D-RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFT-----VSNLPLEMTPNHHR 353
            | |..:.|..::...: |.::| ..|:|.||.::..:::.|..:.:     ||           |
plant   129 DLRHLRAVSTEDAKAF-AEREN-TFFMETSALESMNVENAFTEVLSQIYRVVS-----------R 180

  Fly   354 RLVSVFGAPSPLPPHGSAVGGTKKNALSIKR 384
            :.:.:...|:.||...:...|:|.:..::|:
plant   181 KALDIGDDPAALPKGQTINVGSKDDVSAVKK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 50/226 (22%)
RAS 167..338 CDD:214541 41/173 (24%)
RABA1fNP_200894.1 Rab11_like 11..175 CDD:206660 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.