DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and rasd1

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001072408.1 Gene:rasd1 / 779862 XenbaseID:XB-GENE-483475 Length:266 Species:Xenopus tropicalis


Alignment Length:271 Identity:137/271 - (50%)
Similarity:184/271 - (67%) Gaps:23/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 KNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFP 228
            |||||:|:||||:.||:|||:|||..||||.||||||:||||.|.||.||:|||||||||.||||
 Frog    17 KNCYRMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFP 81

  Fly   229 AMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNK 293
            ||||||.||||:||||||:|:|:|||||.||::.|:|||....|     |.|....:|:::.|||
 Frog    82 AMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKN-----KTKENVDVPIVICGNK 141

  Fly   294 CDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLVS 357
            .|||| :.||..|: ..:.|:|:.|::.|.||::|..:|::|.:|||::.||.||:|:.||: ||
 Frog   142 VDRDFYREVQPHEI-EQLVGEDSKCSYFEVSAKKNSSLDEMFKALFTMAKLPSEMSPDLHRK-VS 204

  Fly   358 VFGAPSPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNLMRSKTMALNEGEGV 422
            |.....   .|..::.|.|      .:...||.|:|.|.||||||.:||..:|:|.:.     |.
 Frog   205 VQYCEI---LHKKSLKGKK------VKEDGDAYGIVAPFARRPSIHSDLMYIRAKAVG-----GG 255

  Fly   423 RSPSRWNRCAL 433
            :|..: .||.:
 Frog   256 QSKDK-ERCVI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 134/268 (50%)
RAS 167..338 CDD:214541 99/171 (58%)
rasd1NP_001072408.1 Rhes_like 20..266 CDD:133343 134/268 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3050
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7509
Inparanoid 1 1.050 243 1.000 Inparanoid score I3229
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 1 1.000 - - FOG0005519
OrthoInspector 1 1.000 - - otm47504
Panther 1 1.100 - - LDO PTHR46149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5615
SonicParanoid 1 1.000 - - X3937
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.