DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and ras-dva2

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001037874.1 Gene:ras-dva2 / 733456 XenbaseID:XB-GENE-5831307 Length:209 Species:Xenopus tropicalis


Alignment Length:222 Identity:75/222 - (33%)
Similarity:116/222 - (52%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 KNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIR-NEVFQLDILDTSGYHPF 227
            |...|||.||::..||:|:::|||.:.|:..:..|:||.|...|... ....:::|:||||.:.|
 Frog     8 KRQIRLVFLGAAGVGKTSLISRFLLDTFDPKHRRTVEELHSTEYEATCGTQVRVEIMDTSGSYEF 72

  Fly   228 PAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGN 292
            ||||:|:..:||.|.||::||..:|||.|..|||.|||.|        |.|..     |:::..|
 Frog    73 PAMRKLNMKSGDAFALVYTMDDPDSFEMVKHLREEILEAK--------GDKSP-----PIVVVAN 124

  Fly   293 KCD--RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRL 355
            |.|  .:.| |..:|.:..:..:.| ...:|.||::|..:.::|..:....|||..::|...||.
 Frog   125 KKDLGGNMK-VPWEEALSTVELEWN-HRLLETSAKENLNVTEVFTEVLREVNLPSRLSPALRRRR 187

  Fly   356 VSVFGAPSPLPPHGSAVGGTKKNALSI 382
            .::....|..||.      .|.|:.||
 Frog   188 ETIPNGGSFKPPM------NKTNSCSI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 74/219 (34%)
RAS 167..338 CDD:214541 61/173 (35%)
ras-dva2NP_001037874.1 P-loop_NTPase 12..209 CDD:393306 74/218 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.