DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and rasd4

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001007782.1 Gene:rasd4 / 553052 ZFINID:ZDB-GENE-050506-133 Length:208 Species:Danio rerio


Alignment Length:216 Identity:78/216 - (36%)
Similarity:115/216 - (53%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRR 232
            |||.:|::..||::::.|||.:.||..:..|:||.|.|.|.:......::|:||||.:.|||||:
Zfish    12 RLVFMGAAGVGKTALIKRFLQDSFEPKHRRTVEELHSKEYEVAGVKVTINIMDTSGSYSFPAMRK 76

  Fly   233 LSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDRD 297
            ||...||.|.||:|:|..||.|.|.||||.|||.|.....             |:::.|||.||.
Zfish    77 LSIQNGDAFALVYSVDDPESLEVVNRLREEILEVKEDKFT-------------PIVVVGNKKDRL 128

  Fly   298 F-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLVSVFGA 361
            . :.|..|:|:..:....|.| |:|.||::|..:.::|..|...:|||..::|...||..:....
Zfish   129 IERRVSADDVLAKVEMDWNNC-FMEASAKENENVMEVFKELLQQANLPSRLSPALRRRRETFPKD 192

  Fly   362 PSPLPPHGSAVGGTKKNALSI 382
            .|..||.      .|.|:.|:
Zfish   193 LSLRPPM------NKTNSCSV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 78/216 (36%)
RAS 167..338 CDD:214541 65/170 (38%)
rasd4NP_001007782.1 small_GTPase 9..173 CDD:197466 66/174 (38%)
Ras_dva 12..208 CDD:206714 78/216 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.