DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and ras-dva1

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001011503.2 Gene:ras-dva1 / 497008 XenbaseID:XB-GENE-1217929 Length:211 Species:Xenopus tropicalis


Alignment Length:212 Identity:74/212 - (34%)
Similarity:110/212 - (51%) Gaps:42/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNE----VFQLDILDTS 222
            |..:..|||..|::..||::::.|||.:||::.|..|:||    :|.:..|    ..::.|||||
 Frog     6 SPSDTVRLVFFGAAGVGKTALIQRFLNDRFDDRYRRTVEE----MYCLNPEPGALQLRIQILDTS 66

  Fly   223 GYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPM 287
            |.:.|||||:||...||.|.||||:...:||:||.|||..|::.|..|             ::|:
 Frog    67 GSYSFPAMRKLSIQQGDAFALVFSLSEPDSFQEVERLRSEIIQVKGDA-------------EVPI 118

  Fly   288 ILAGNKCDRDFKTVQVDEVMGYIAGQ------------DNCCTFVECSARQNYRIDDLFHSLFTV 340
            ::.||         |:|...|..|||            :..|.:||.||:.:||:.|:||.|...
 Frog   119 VVVGN---------QMDLFPGLEAGQQVDLRAAATAELEWDCGYVETSAKVDYRVWDVFHQLIRR 174

  Fly   341 SNLPLEMTPNHHRRLVS 357
            .|.|..::|...||..|
 Frog   175 VNSPAWLSPALERRRAS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 73/207 (35%)
RAS 167..338 CDD:214541 66/186 (35%)
ras-dva1NP_001011503.2 Ras_dva 12..211 CDD:206714 73/206 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.