DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and Ras85D

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:174 Identity:61/174 - (35%)
Similarity:93/174 - (53%) Gaps:21/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 YRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMR 231
            |:||::|:...|||::..:.:.|.|.:.|.||||:.:||...|..|...||||||:|...:.|||
  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68

  Fly   232 RLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDR 296
            .....||:.|:|||:::|.:|||::...||.|...|.|             .::||:|.|||||.
  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDA-------------EEVPMVLVGNKCDL 120

  Fly   297 ---DFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337
               :....|..||     .:.....::|.||:....:||.|::|
  Fly   121 ASWNVNNEQAREV-----AKQYGIPYIETSAKTRMGVDDAFYTL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 61/174 (35%)
RAS 167..338 CDD:214541 61/174 (35%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 61/174 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.