DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and CG14669

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001262281.1 Gene:CG14669 / 40652 FlyBaseID:FBgn0037326 Length:306 Species:Drosophila melanogaster


Alignment Length:282 Identity:67/282 - (23%)
Similarity:113/282 - (40%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 STTHSTDEASPPQAHVVTFLDESTAGGSNGAVTSSRLVTTAELHQAHM-LEHHSNLDAIEQADDF 145
            |..:..|.|.....::.|  ..:.|.|:.|  :.|:...||...:..: :|.|.....|.. ...
  Fly    21 SVDYVGDSARTAAGNIKT--GAAAAAGAKG--SKSKATATAPTTKISIEMELHIQNKCISAXRIT 81

  Fly   146 IYGPGAGLSLCDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYR-- 208
            :.| ||       ..|..:...:...||::..||:||:.:|..:.|...:..|.   |||:|:  
  Fly    82 LEG-GA-------EPPWLQGPLKAAFLGATGVGKTSILQQFFYHDFPRTHQTTT---HRKIYKNC 135

  Fly   209 ------IRNEVFQLDILDTSGYHPFPA--------MRRLSFLTGDLFILVFSMDSRESFEEVVRL 259
                  ||    :|.:||......|||        ...|...|...::||:.|.:.|:|:....:
  Fly   136 LVCDTCIR----ELMVLDVPPQKRFPADNFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSM 196

  Fly   260 RENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD---------RDFKTVQVDEVMGYIAGQDN 315
            |:.||::          |..:.   ..:|:.|||.|         ::.|.:..      :..:..
  Fly   197 RDQILDS----------FSHRD---FSIIVVGNKFDNVTEAQANSQELKDIST------LVRKHW 242

  Fly   316 CCTFVECSARQNYRIDDLFHSL 337
            .|.:|||||:.||:|.|:|..|
  Fly   243 RCGYVECSAQYNYKIGDVFREL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 50/196 (26%)
RAS 167..338 CDD:214541 50/196 (26%)
CG14669NP_001262281.1 P-loop_NTPase 95..267 CDD:304359 50/196 (26%)
small_GTPase 96..265 CDD:197466 50/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.