DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and rasd1

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_956826.1 Gene:rasd1 / 393504 ZFINID:ZDB-GENE-040426-1473 Length:265 Species:Danio rerio


Alignment Length:259 Identity:133/259 - (51%)
Similarity:178/259 - (68%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPF 227
            ||||||:|:|||::.||::||:|||..||||.||||||:||||||.|:.:|:|||||||||.|||
Zfish    16 AKNCYRMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIEDFHRKLYSIKGDVYQLDILDTSGNHPF 80

  Fly   228 PAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGN 292
            |||||||.||||:||||||:|:||||.||.||::.|.|||....|     |.|....:|:::.||
Zfish    81 PAMRRLSILTGDVFILVFSLDNRESFHEVQRLKQQIYETKSCLKN-----KTKENVDVPLVICGN 140

  Fly   293 KCDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLV 356
            |.||:| :.||.||:...|||.:.|..| |.||::|..:|.:|..|||::.||.||:|:.||: |
Zfish   141 KGDREFYREVQRDEIEQLIAGDEQCAYF-EISAKRNTNVDQMFQRLFTLAKLPNEMSPDLHRK-V 203

  Fly   357 SVFGAPSPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNLMRSKTMALNEGE 420
            ||        .:...:  .||:..:.|.:..||.|:|.|.|||||:.:||..::.|  |:..|:
Zfish   204 SV--------QYCDIL--HKKSLKNKKVKDGDAYGIVAPFARRPSVHSDLMYIKEK--AIGGGQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 129/255 (51%)
RAS 167..338 CDD:214541 98/171 (57%)
rasd1NP_956826.1 small_GTPase 18..190 CDD:197466 103/177 (58%)
Rhes_like 20..265 CDD:133343 129/255 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 192 1.000 Domainoid score I3171
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7509
Inparanoid 1 1.050 238 1.000 Inparanoid score I3339
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 1 1.000 - - FOG0005519
OrthoInspector 1 1.000 - - oto39478
orthoMCL 1 0.900 - - OOG6_107719
Panther 1 1.100 - - LDO PTHR46149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5615
SonicParanoid 1 1.000 - - X3937
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.