DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and CG8519

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:174 Identity:43/174 - (24%)
Similarity:74/174 - (42%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDT--SGYHPFPAM 230
            ::.::|:...|||:::.|||..|:...|....|..::....:..|....:||||  .....:|..
  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYPNA 81

  Fly   231 RRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD 295
            ..| ....|..:||:|:..|:||..:.|.:.::..                  ..|:.|..||.|
  Fly    82 AEL-VQWADGLLLVYSITDRKSFNYIRRAKSDLQS------------------DTPVQLCANKVD 127

  Fly   296 R-DFKTVQVDEVMGYIAGQDNCCTFVECSARQNY-RIDDLFHSL 337
            . ..:.|..||  |.|..:|..|.|.|.||..:. ::.::|:.|
  Fly   128 MVHLRQVSRDE--GEILAKDFECKFSEVSAADHVDQVAEVFNEL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 43/174 (25%)
RAS 167..338 CDD:214541 43/174 (25%)
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 43/174 (25%)
P-loop_NTPase 17..173 CDD:304359 43/174 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.