DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and CG5160

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster


Alignment Length:294 Identity:77/294 - (26%)
Similarity:125/294 - (42%) Gaps:52/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRR 232
            ::::||.|..||:::|.||:..||...|.|.:|:.:.....:..|..|.||||.:|        :
  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATG--------Q 80

  Fly   233 LSFLTG----------DLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPM 287
            |..|.|          |.|||::|:..:.||:|..||:..|...| .....||..|:.:| .||:
  Fly    81 LQELDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNK-RRRKLGSASKEYAL-DIPV 143

  Fly   288 ILAGNKCDRDFKTVQVDEVMGYIAGQD-----NCCTFVECSARQNY-RIDDLFHSLFTVSNLPLE 346
            ||.|||.|:     ..|.::....||.     :|..|.|.|.|::. ::.::|..:|....: ..
  Fly   144 ILVGNKTDQ-----PGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRV-FS 202

  Fly   347 MTPNHHRRLVSVFGAPSPLPPHGSAVGGTKKNALSIKRR----FSDAC------------GVVTP 395
            ..|...|....|......|.|...:......::|.:.|.    ...||            ..:|.
  Fly   203 KFPKLKRSTSDVANTDGILTPDSGSCSFYDASSLGVGRHSFLVIGSACLEESNGDHTESTDEITS 267

  Fly   396 NARRPSIRTDLNL-MRSKTMALNEGEGVRSPSRW 428
            ::...| |:|::. .||:  |..:|..:..|.||
  Fly   268 SSLSSS-RSDIDAPFRSR--ASTDGTLLSRPRRW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 77/294 (26%)
RAS 167..338 CDD:214541 56/185 (30%)
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 56/186 (30%)
RERG_RasL11_like 24..200 CDD:206713 57/190 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.