DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and CG13375

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:260 Identity:83/260 - (31%)
Similarity:121/260 - (46%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDT 221
            ||::..|...:::|::||::.||:||:.:||.|.|...|..||||.|:..:.|......||||||
  Fly    38 DDAIGPANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDT 102

  Fly   222 SGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIP 286
            :|.:.|||||.||..:.|.||||:.:....:||||..:|:.|.||             |:...:|
  Fly   103 AGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHET-------------KATTAVP 154

  Fly   287 MILAGNKCD--RDFKT------------VQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337
            :::.|||.|  .|.:|            |.||...|          |||.||..|..|..:|..|
  Fly   155 IVVVGNKIDLLADGETEREVEYATTESVVTVDWENG----------FVEASASSNENITQVFKEL 209

  Fly   338 FTVSNLPLEMTPNHHRRLVSV---FGAPSPLPP--------HGSAVGGTKKNALSIKRRFSDACG 391
            ...:.:...::|...||..|:   .|...|..|        |.::.|||..:..|.....|.:.|
  Fly   210 LAQAKITYNLSPALRRRRQSLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSASTSSAAAAASSSGG 274

  Fly   392  391
              Fly   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 80/250 (32%)
RAS 167..338 CDD:214541 65/184 (35%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 66/189 (35%)
Ras_dva 49..239 CDD:206714 71/212 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108151at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.