DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and RASD2

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_016884190.1 Gene:RASD2 / 23551 HGNCID:18229 Length:278 Species:Homo sapiens


Alignment Length:269 Identity:131/269 - (48%)
Similarity:180/269 - (66%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 CDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILD 220
            |..|:| |||.||:|:||:||.||||||:|||..|||:.||||||:||||:|.||.:::||||||
Human    22 CTLSVP-AKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILD 85

  Fly   221 TSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKI 285
            |||.||||||||||.||||:||||||:|:||||:||.||::.|||.|....|     |.|...::
Human    86 TSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKN-----KTKEAAEL 145

  Fly   286 PMILAGNKCDRD--FKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMT 348
            ||::.|||.|..  .:.|...|....::|.:||..| |.||::|..:|::|:.||:::.||.||:
Human   146 PMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYF-EVSAKKNTNVDEMFYVLFSMAKLPHEMS 209

  Fly   349 PNHHRRLVSVFG-APSPLPPHGSAVGGTKKNALSIKR-RFSDACGVVTPNARRPSIRTDLNLMRS 411
            |..||::...:| |..|.|             ..::| :..||.|:|:|.|||||:.:||..:::
Human   210 PALHRKISVQYGDAFHPRP-------------FCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKA 261

  Fly   412 KTMALNEGE 420
            |  .|.||:
Human   262 K--VLREGQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 125/258 (48%)
RAS 167..338 CDD:214541 95/172 (55%)
RASD2XP_016884190.1 Rhes_like 32..278 CDD:133343 125/258 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3248
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3413
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 1 1.000 - - FOG0005519
OrthoInspector 1 1.000 - - otm40330
orthoMCL 1 0.900 - - OOG6_107719
Panther 1 1.100 - - O PTHR46149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5615
SonicParanoid 1 1.000 - - X3937
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.