DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and ssr-2

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_508490.4 Gene:ssr-2 / 191965 WormBaseID:WBGene00006055 Length:335 Species:Caenorhabditis elegans


Alignment Length:190 Identity:64/190 - (33%)
Similarity:104/190 - (54%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LCDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDIL 219
            :|::.       ||||:|||::.||::|:.|:|.|.|...|..|||:.|.:.:||:.....||||
 Worm    16 MCEER-------YRLVVLGSAKVGKTNIIRRYLYNEFSSKYKETIEDLHSREFRIQGVPLPLDIL 73

  Fly   220 DTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPK 284
            ||:  ..||.|||||..:...|:||||:|...||:|:..:.:.|..            ::..|.:
 Worm    74 DTN--FNFPDMRRLSIASASAFLLVFSVDDVTSFKEMSDIWQEICS------------RRSDLNE 124

  Fly   285 IPMILAGNKCDRDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLP 344
            :|:::.|||||.:.|.:..:....:.....:...::|.||:.|.||.|:|.:|..:|..|
 Worm   125 LPIVVVGNKCDVENKKIYEETAKAFTNRLSSDVRYIEVSAKDNIRITDVFRTLLELSGFP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 63/178 (35%)
RAS 167..338 CDD:214541 60/170 (35%)
ssr-2NP_508490.4 P-loop_NTPase 22..178 CDD:393306 59/169 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.