DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and Rheb

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:173 Identity:53/173 - (30%)
Similarity:92/173 - (53%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSG---YHPFPAM 230
            :.|:|....||||:..:|:..:|.::|.||||....|:.|::::.:.:.::||:|   |..||..
  Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQ 72

  Fly   231 RRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD 295
            ..:.:   ..::||:|:.|::|||.|..:.|.:|:.          ..||   .:|::|.|||.|
  Fly    73 YSMDY---HGYVLVYSITSQKSFEVVKIIYEKLLDV----------MGKK---YVPVVLVGNKID 121

  Fly   296 -RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337
             ...:||..:|  |....:.....|:|.||:||..:.|:||.|
  Fly   122 LHQERTVSTEE--GKKLAESWRAAFLETSAKQNESVGDIFHQL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 53/173 (31%)
RAS 167..338 CDD:214541 53/173 (31%)
RhebNP_730950.2 RheB 5..182 CDD:206709 53/173 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.