DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp and Vwf

DIOPT Version :9

Sequence 1:NP_001246651.1 Gene:Mp / 38769 FlyBaseID:FBgn0260660 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_446341.1 Gene:Vwf / 116669 RGDID:621759 Length:2812 Species:Rattus norvegicus


Alignment Length:471 Identity:91/471 - (19%)
Similarity:154/471 - (32%) Gaps:133/471 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 PGPPGPPG------PPGLPGLSISGPK------------------GEPGVDSRSSFFGDA----- 671
            |.|..||.      .||:.|:|..|||                  ||...:....|..:.     
  Rat  1465 PAPTKPPQVAHITVSPGISGVSSPGPKRKSLVLDVVFVLEASDEVGEANFNKSKEFLEEVIQRMD 1529

  Fly   672 -------------SY-----YGRPGARSSLDELKALRELQDLRDRPDGTAE----------PPRQ 708
                         ||     |....|:|..|.|:.:||::........|.:          .|.|
  Rat  1530 VSPAGTHIAVLQYSYTVNVEYTFKEAQSKEDVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQ 1594

  Fly   709 PGHSHKHEETLGLVDGEEPYFSASSSNMNMKIVP-GAVTFQNIDEMTKKSALNPPGTLAYITEEE 772
             |...:....:.:|.|............::::|| |..:..|:.|:.:   ::.|....:|.:.|
  Rat  1595 -GDREQAPNLVYMVTGNPASDEIRRLPGDIQVVPIGVGSRANLQELER---ISRPIAPIFIQDFE 1655

  Fly   773 A-------LLVRVNKGWQYIALGTLVPIATPAPPTTVA---------PSMRFDLQSKNLLNSPPP 821
            .       |::|.....:.:.|.||.|:...:.|..|.         |:..|| :.|:...:   
  Rat  1656 TLPREAPDLVLRTCCSKEGLQLPTLPPLPDCSQPLDVVLLLDGSSSLPASSFD-EMKSFAKA--- 1716

  Fly   822 LLNTPTWYPRMLRVAALNEPSTGDLQGI----RGADFACYRQG------RRAG--LLGTFKAFLS 874
            .::.....|.:.:|:.:   ..|.:..|    ..|....|.|.      :..|  .:|...||..
  Rat  1717 FISKANIGPHLTQVSVI---QYGSINTIDVPWNVAQEKAYLQSLVDLMQQEGGPSQIGNALAFAV 1778

  Fly   875 SRVQNLDTIVRPA----------DRDLPVVNTRGDVLFNSWKGIFN-GQGGFFSQAP-RIYSFSG 927
            ..|.:.....||.          |..|..|:|..|...::...:|. |.|..:.:|. ||.:..|
  Rat  1779 RYVTSQIHGARPGASKAVVMIIMDTSLDSVDTAVDAARSNRVAVFPIGVGDRYDEAQLRILAGPG 1843

  Fly   928 -----------KNVMTDSTWPMKMVWH-------GSLPNGERSMDTYCDAWHSGD--HLKGSFAS 972
                       ::::|..| |....:|       |...:.:.:.....|.|...|  |.....| 
  Rat  1844 ASSNVVKLQQVEDLLTMVT-PGNSFFHRLCSGFSGVCVDEDGNEKRPGDVWTLPDQCHTVTCLA- 1906

  Fly   973 NLDGHKLLEQKRQSCD 988
              :|..||:..|.:||
  Rat  1907 --NGQTLLQSHRVNCD 1920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MpNP_001246651.1 LamG 58..222 CDD:304605
Collagen 378..432 CDD:189968
Collagen 464..518 CDD:189968
Collagen 494..615 CDD:189968
Endostatin-like 831..999 CDD:238151 41/202 (20%)
VwfNP_446341.1 VWD 35..179 CDD:278521
C8 218..292 CDD:214843
TIL 295..348 CDD:280072
VWD 377..540 CDD:214566
C8 580..648 CDD:285899
TIL 652..707 CDD:280072
VWD 856..1011 CDD:214566
C8 1053..1127 CDD:214843
TIL 1146..1196 CDD:280072
VWA_N2 1198..1276 CDD:292782
VWA 1277..1449 CDD:214621
VWA 1498..1658 CDD:278519 26/163 (16%)
VWA 1691..1862 CDD:278519 32/177 (18%)
VWD 1950..2102 CDD:278521
C8 2136..2199 CDD:285899
TIL 2203..2254 CDD:280072
VWC 2257..2321 CDD:214564
VWC 2431..2494 CDD:214564
VWC 2581..2643 CDD:302663
CT 2726..2807 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.