DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FKH2

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_014331.3 Gene:FKH2 / 855656 SGDID:S000005012 Length:862 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:72/244 - (29%)
Similarity:116/244 - (47%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SNNTILSANDYQLLTSQEQAGQQQ---PQQLPAQQLQHSPGGG-YMSRISTSPSQ--VISNAHGM 245
            :||.:|.    .::.....|.|:|   .||:...:|..|.|.. :.|..:..||:  :.:|.:..
Yeast   208 NNNPLLR----DIIKQSNYAKQRQLTSNQQIKGFKLYGSGGNAPFGSGANLGPSEQGIFNNNNNS 268

  Fly   246 -----------PVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPD 299
                       |  ||::|::: :.::|...:||...   .|.:..:..|.:..||.. .|...|
Yeast   269 KNKNGYFTSINP--NYTASTTT-SNTINPQAASPQGP---PNTIIAANFVDSYKSSNA-YPQALD 326

  Fly   300 TTK--KSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHN 362
            .|.  .....|..||..||..||..||..||.|.::|::||.|:..:|.::|....||:||:|||
Yeast   327 FTSDLSHDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHN 391

  Fly   363 LSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDE------GSLRR 405
            ||||:.|:|:|:  ...:||||..|.|.|:....|.::      |.:||
Yeast   392 LSLNKAFEKVPR--RPNEPGKGMKWRISESYQQEFLNKWNTGKVGKIRR 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 39/87 (45%)
FKH2NP_014331.3 COG5025 1..610 CDD:227358 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.