DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FKH1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:74/251 - (29%)
Similarity:111/251 - (44%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LNH---QYASTIKYCSNNTILSANDYQLLTSQEQAGQQQPQQLPAQQLQHSPGGGYMSRISTSPS 236
            |||   :..||.....||..|..|..:..|...:...|:..:|  |||.|.    :....|:|..
Yeast   182 LNHLMPKLLSTYGTNGNNNPLLRNIIEGSTYLREQRLQEEARL--QQLDHL----HTPLSSSSDV 240

  Fly   237 QVISNAHGMPVL--------NYSSSSSSPAKSLNGSESSPPSQN--HLENKVSGSAVVGTGGSSQ 291
            ..|.:.||..::        ||:.....|....:.|.::..:.|  |:||               
Yeast   241 NPIGDPHGDTIMMEEDEEDENYTRGGIRPNTYTSSSNNAVTNGNVPHIEN--------------- 290

  Fly   292 QDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWK 356
               ||.....:    .|..||..||.:||..||..:|.|.::|::||.::..:|.|:|...:.|:
Yeast   291 ---PSDLSLDE----NRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQ 348

  Fly   357 NSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDE---GSLRRRPRG 409
            ||||||||||:.|:|:||  ..|:.|||..|.|.:.....|.::   |.|.:..||
Yeast   349 NSVRHNLSLNKAFEKVPK--RAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 38/87 (44%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.