DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FHA2

DIOPT Version :10

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_187378.1 Gene:FHA2 / 819910 AraportID:AT3G07220 Length:320 Species:Arabidopsis thaliana


Alignment Length:112 Identity:24/112 - (21%)
Similarity:33/112 - (29%) Gaps:33/112 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MPVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGT--------GGSSQQDAPSTPDTT 301
            :||.:.......|...::|..|..|..|:.....|||...|.        ......|.....|..
plant   115 LPVRSILGGPLGPRHHVSGQTSVVPYHNYQSGPGSGSGKKGVRSRELYEYDDEDDDDDDDEEDDM 179

  Fly   302 KKSG--TRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYE 346
            :.||  |||.           ||.:            :||..:|..|
plant   180 RGSGKKTRRD-----------GHEV------------VYASGEKKRE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 FH_FOX 312..391 CDD:469596 6/35 (17%)