DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxp4

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_017173175.1 Gene:Foxp4 / 74123 MGIID:1921373 Length:692 Species:Mus musculus


Alignment Length:476 Identity:116/476 - (24%)
Similarity:189/476 - (39%) Gaps:138/476 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MDATPTA-TPVSAAQHYSLSALHSMGTPPASSSPIP---PYGVLMTAHSAGSASPQSNSKTPTDL 149
            :|...|| |..|.|....:|       ||.|..|:|   |  .::|:....|    |:.:||:..
Mouse   256 LDLASTAVTATSFASPPKVS-------PPLSHHPLPNGQP--TVLTSRRDSS----SHEETPSSH 307

  Fly   150 P----------------QDL---------QYASSSTSTAK-------VQPLQVQLQPLNHQYAST 182
            |                :||         ::|....|||:       ||.|::||...:.:..:.
Mouse   308 PLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQAM 372

  Fly   183 IKYCSNNTILSANDYQLLTSQEQAGQQQPQQLPAQQLQHSPGGGYMSRISTSPSQVISNAHGMP- 246
            :.:..            :...|.....||......||...||       |:|.|:|..:|...| 
Mouse   373 MAHLH------------MRPSEPKPFSQPHLPHCSQLNPVPG-------SSSFSKVTVSADPFPD 418

  Fly   247 -VLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQ---DAPSTPDTTKKSGTR 307
             :::..:|:::|...|.     ||.        .|||.:.:||.:::   |...:|.:::.:...
Mouse   419 GLVHPPTSAAAPVTPLR-----PPG--------LGSASLHSGGPARRRSNDKFCSPISSELAQNH 470

  Fly   308 R-----PEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNE 367
            .     ..:|..:|.::|..||.|:|..:|||:|||.:..:.:.:||.....|||:|||||||::
Mouse   471 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHK 535

  Fly   368 CFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYG 432
            ||.::       :..||..||:||.       |...||.|:...|...||      |......||
Mouse   536 CFVRV-------ENVKGAVWTVDER-------EYQKRRPPKMTGSPTLVK------NMISGLSYG 580

  Fly   433 DAGMDNGNYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYT 497
            ..   |.:|.|:.|.:|:..          ....|..:|.:| ::....|...:|:...|||.  
Mouse   581 AL---NASYQAALAESSFPL----------LSNPGMLNPGSA-SSLLPLSQEDLGVPGEPLPS-- 629

  Fly   498 NISCLAAGGNVNGSATTPPLA 518
                       |||::.|.|:
Mouse   630 -----------NGSSSPPRLS 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 33/87 (38%)
Foxp4XP_017173175.1 FOXP-CC 309..376 CDD:374402 11/66 (17%)
COG5025 <375..>572 CDD:227358 65/248 (26%)
FH 479..551 CDD:214627 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.