DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxl1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:308 Identity:96/308 - (31%)
Similarity:132/308 - (42%) Gaps:67/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DAPSTP----DTTKKSGTRR---PEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRG 350
            :.|..|    ..|..:|..|   |:||..|||.:|..||:::|..::||:.||.::...:.|:..
  Rat    24 ERPGLPLAFAPATALAGPGRVEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHD 88

  Fly   351 PYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIK 415
            ...||:||:||||||||||.|:|:..  |:||||:|||:|.....:||: |:.|||.|      |
  Rat    89 NRQGWQNSIRHNLSLNECFVKVPREK--GRPGKGSYWTLDPRCLDMFEN-GNYRRRKR------K 144

  Fly   416 VKPYAGHANG---YYASGYGDAGMDNGNYYASPAFASY------DYS---AAGATGVS---PAGG 465
            .||.||....   .......:.|.|.|    ||..|:.      |.|   |||.|..|   |..|
  Rat   145 PKPAAGSPEAKRTRVEPRESEVGCDVG----SPNLATARPMHEPDRSQSPAAGGTARSALLPWPG 205

  Fly   466 QGFADP------WNAHAAHSGSSSVGV-------GMGVGPLPQYTNISCLAAGGNVNGSATTPPL 517
            ....||      .:|.|..||.....|       |..:.|.|          .|:..||.:....
  Rat   206 PELRDPDADRTIQDAGAVASGQLERPVHYPVHHLGSSLRPAP----------SGSPKGSKSKSFS 260

  Fly   518 AHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGSL 565
            ..|.|.:.|..:|.:...|.:..|..         |.|.|..|::..|
  Rat   261 IDSILAVRPKPASGAEAPGISKPLPG---------ALGSSLLTASSGL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 40/87 (46%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 41/90 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.