DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FOXD4L6

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001078945.1 Gene:FOXD4L6 / 653404 HGNCID:31986 Length:417 Species:Homo sapiens


Alignment Length:381 Identity:99/381 - (25%)
Similarity:136/381 - (35%) Gaps:122/381 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SSPAKSLNGS---------------------ESSPPSQNHLENKVS-GSAVVGTGGSSQQ----- 292
            |:|.:||..|                     |....||..||..:. |..|...||.:..     
Human    11 STPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEAASQQFLEQSLQPGLQVARWGGVALPREHIE 75

  Fly   293 --DAPSTPDT--TK----------KSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQK 343
              ..||.|..  ||          ....|:|.||..|||.:|..||.::|..:||||.|.|::..
Human    76 GGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISG 140

  Fly   344 SYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPR 408
            .:.::|..:..|:||:|||||||:||.|:|:  ..|.|||||||::|..|..:|::...||||.|
Human   141 RFPYYRRKFPAWQNSIRHNLSLNDCFVKIPR--EPGHPGKGNYWSLDPASQDMFDNGSFLRRRKR 203

  Fly   409 GYRSKIKV------------------KPYAGHANGYYA------SGYGDAGMDNGNY-------- 441
            ..|.::..                  .|:.|...|..|      ..|.:.......|        
Human   204 FKRHQLTPGAHLPHPFPLPAAHAALHNPHPGPLLGAPAPPQPVPGAYPNTAPGRRPYALLHPHPL 268

  Fly   442 ----YASPAFASYDYSAAGATGVSPA-------------GGQGFADPWNAHAAHSGSSSVGVGMG 489
                .::|.:|.....|.||...:||             |.:  |..|..|.....|.|.     
Human   269 RYLLLSAPVYAGAPKKAEGAALATPAPFPCCSPHLVLSLGRR--ARVWRRHREADASLSA----- 326

  Fly   490 VGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDY 545
                   ..:.|..:|..|.|.....|                .|.||.||..||:
Human   327 -------LRVLCKGSGERVQGLRRVCP----------------RPRGATATCSSDH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 41/87 (47%)
FOXD4L6NP_001078945.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 5/34 (15%)
Forkhead 108..194 CDD:278670 41/87 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.