DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxq1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:380 Identity:113/380 - (29%)
Similarity:158/380 - (41%) Gaps:85/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 AHGMPV---LNYSSSSSSPAK-SLNGSES----------SPPS-QNHLENKVSGSAVVGTGGSSQ 291
            |||..:   |..:.||..|:. |..|.:|          ||.: :..::.:..|.....:||:|.
  Rat    11 AHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANSPAAGRGAVDLEGGGGERNSSGGAST 75

  Fly   292 QDAPSTPDTTK---------------------KSGTRRPEKPALSYINMIGHAIKESPTGKLTLS 335
            ||.|...|.::                     |..|||| ||..|||.:|..||::|..|:|||:
  Rat    76 QDDPEVTDGSRTQASPVGPCAGSVGGGEGARSKPYTRRP-KPPYSYIALIAMAIRDSAGGRLTLA 139

  Fly   336 EIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKP-GKGNYWTIDENSAHLFED 399
            ||..||...:.||||.|.||:||||||||||:||.|:.:  ...:| ||.|||.::.||.:.|.|
  Rat   140 EINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLR--DPSRPWGKDNYWMLNPNSEYTFAD 202

  Fly   400 EGSLRRRPRGYRSKIKVKPYAGHANGYYASGY-------GDAGMDNGNYYASPAFASYDYSAAGA 457
            ....|||.|           ..|.....|||.       |.||...    .:|...|...:.:.|
  Rat   203 GVFRRRRKR-----------LSHRTTVSASGLRPEEAPPGPAGTPQ----PAPTAGSSPIARSPA 252

  Fly   458 ---TGVSPAG--GQGFA------DPWNAHAAHSGSSSVGVGM-----GVGPLPQYTNISCLAAGG 506
               .|.|||.  ...||      .|:.:.  ..|..::||.:     ...||..|..:...::||
  Rat   253 RQEEGSSPASKFSSSFAIDSILSKPFRSR--RDGDPALGVQLPWSAAPCPPLRAYPALLPASSGG 315

  Fly   507 NV-----NGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGY 556
            .:     .|:.....||.....:.|:|....:||..||..:....|..:..|..|
  Rat   316 ALLPLCAYGAGEPTLLASRGAEVQPAAPLLLAPLSTAAPAKPFRGPETAGAAHLY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 46/88 (52%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 43/79 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.